VEGFA Protein, Rabbit, Recombinant (His)

• Catalog Number: orb1976703
• Category: Proteins
• Description: VEGFA Protein, Rabbit, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 51.7 kDa and the accession number is XP_002714743.1.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 51.7 kDa (predicted)
• UniProt ID: XP_002714743.1
• Protein Sequence: YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWRLGAGEPGSWTGEAAVCADSAPAARAPQALARASAPGARGARGGAEESGPSRSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEEGDNKPHEVVKFMEVYRRSYCQPIETLVDIFQEYPDEIEYIFKPSCVPLVRCGGCCNDESLECVPTEEFNVTMQIMRIKPHQGQHIGEMSFLQHNKCECRCDKPRR
• Expression System: P. pastoris (Yeast)
• Biological Origin: Rabbit
• Biological Activity: VEGFA Protein, Rabbit, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 51.7 kDa and the accession number is XP_002714743.1.
• Expression Region: 51-511 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.