VAPA MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2291751
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human VAPA protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP
• Reactivity: Human
• Immunogen: VAPA (ENSP00000217602, 1 a.a. ~ 242 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL
• NCBI: ENSP00000217602
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of VAPA transfected lysate using anti-VAPA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with VAPA purified MaxPab mouse polyclonal antibody (B01P).