You have no items in your shopping cart.
Cart summary
Vaccinia virus (strain Western Reserve) OPG161 Protein (His)
Catalog Number: orb1976257
| Catalog Number | orb1976257 |
|---|---|
| Category | Proteins |
| Description | Coordinates the incorporation of A36 into wrapped enveloped virion (EV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles. Vaccinia virus (strain Western Reserve) OPG161 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.2 kDa and the accession number is P68617. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 16.2 kDa (predicted) |
| UniProt ID | P68617 |
| Protein Sequence | VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | VACV |
| Biological Activity | Coordinates the incorporation of A36 into wrapped enveloped virion (EV) membranes and, subsequently, the production of actin tails. Therefore plays an essential role in efficient cell-to-cell spread of viral particles. Vaccinia virus (strain Western Reserve) OPG161 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.2 kDa and the accession number is P68617. |
| Expression Region | 57-185 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
