Vaccinia virus (strain Western Reserve) OPG190 Protein (His)

• Catalog Number: orb1976252
• Category: Proteins
• Description: Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Participates also in wrapping mature virions (MV) to form enveloped virions (EV). Vaccinia virus (strain Western Reserve) OPG190 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is Q01227.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 31.1 kDa (predicted)
• UniProt ID: Q01227
• Protein Sequence: YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
• Expression System: P. pastoris (Yeast)
• Biological Origin: VACV
• Biological Activity: Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Participates also in wrapping mature virions (MV) to form enveloped virions (EV). Vaccinia virus (strain Western Reserve) OPG190 Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 31.1 kDa and the accession number is Q01227.
• Expression Region: 18-279 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.