You have no items in your shopping cart.
Cart summary
Vaccinia virus (strain LC16m8) B5 Protein (E. coli, His)
Catalog Number: orb1976242
| Catalog Number | orb1976242 |
|---|---|
| Category | Proteins |
| Description | Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional. Vaccinia virus (strain LC16m8) B5 Protein (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 14.1 kDa and the accession number is P24284. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 14.1 kDa (predicted) |
| UniProt ID | P24284 |
| Protein Sequence | YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK |
| Expression System | E. coli |
| Biological Origin | VACV |
| Biological Activity | Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional. Vaccinia virus (strain LC16m8) B5 Protein (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 14.1 kDa and the accession number is P24284. |
| Expression Region | 18-92 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
