You have no items in your shopping cart.
Cart summary
Vaccinia virus (strain Copenhagen) OPG190 Protein (His & Myc)
Catalog Number: orb1976255
| Catalog Number | orb1976255 |
|---|---|
| Category | Proteins |
| Description | Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EEV) to allow virion entry into host cells. Participates also in wrapping intracellular mature virions (IMV) to form intracellular enveloped virions (IEV). Vaccinia virus (strain Copenhagen) OPG190 Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 36.5 kDa and the accession number is P21115. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 36.5 kDa (predicted) |
| UniProt ID | P21115 |
| Protein Sequence | YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH |
| Expression System | E. coli |
| Biological Origin | VACV |
| Biological Activity | Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EEV) to allow virion entry into host cells. Participates also in wrapping intracellular mature virions (IMV) to form intracellular enveloped virions (IEV). Vaccinia virus (strain Copenhagen) OPG190 Protein (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 36.5 kDa and the accession number is P21115. |
| Expression Region | 18-279 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
