UVRAG monoclonal antibody (M04), clone 2E8

• Catalog Number: orb2291980
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant UVRAG.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E8
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: UVRAG (NP_003360.2, 601 a.a. ~ 699 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LPSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK
• NCBI: NP_003360.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged UVRAG is 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to UVRAG on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of UVRAG expression in transfected 293T cell line by UVRAG monoclonal antibody (M04), clone 2E8. Lane 1: UVRAG transfected lysate (Predicted MW: 78.2 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).