You have no items in your shopping cart.
Cart summary
Ustilago maydis P6 virus (UmV6) KP6 killer toxin (His)
Catalog Number: orb1976269
| Catalog Number | orb1976269 |
|---|---|
| Category | Proteins |
| Description | This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death. Ustilago maydis P6 virus (UmV6) KP6 killer toxin (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 10.6 kDa and the accession number is P16948. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 10.6 kDa (predicted) |
| UniProt ID | P16948 |
| Protein Sequence | NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | UmV6 |
| Biological Activity | This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death. Ustilago maydis P6 virus (UmV6) KP6 killer toxin (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 10.6 kDa and the accession number is P16948. |
| Expression Region | 28-105 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
