USP48 monoclonal antibody (M01), clone 3G4

• Catalog Number: orb2290756
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant USP48.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3G4
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: USP48 (NP_115612, 110 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAY
• NCBI: NP_115612
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged USP48 is approximately 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to USP48 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

USP48 monoclonal antibody (M01), clone 3G4 Western Blot analysis of USP48 expression in HeLa.

Western Blot detection against Immunogen (37.84 KDa).