USP3 monoclonal antibody (M01), clone 1H2

• Catalog Number: orb2291651
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant USP3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1H2
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: USP3 (NP_006528, 421 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFYVEHQAKAGSDKL
• NCBI: NP_006528
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged USP3 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to USP3 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of USP3 expression in transfected 293T cell line by USP3 monoclonal antibody (M01), clone 1H2. Lane 1: USP3 transfected lysate (58.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).