USP18 Rabbit Polyclonal Antibody

• Catalog Number: orb579731
• Category: Antibodies
• Description: Rabbit polyclonal antibody to USP18
• Target: USP18
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human USP18
• Protein Sequence: Synthetic peptide located within the following region: MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH
• UniProt ID: Q9UMW8
• MW: 43 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ISG43, UBP43, PTORCH2
• Research Area: Protein Biochemistry
• Note: For research use only
• NCBI: NP_059110

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.

USP18 antibody - N-terminal region (orb579731) validated by WB using Mouse Brain lysate at 2 ug/ml.

WB Suggested Anti-USP18 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.