You have no items in your shopping cart.
Cart summary
Item 1 of 5
Item 1 of 5
USP15 monoclonal antibody (M01), clone 1C10
Catalog Number: orb2291652
| Catalog Number | orb2291652 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a full length recombinant USP15. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG1 kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | USP15 (AAH20688, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC |
| Tested applications | ELISA, IF, WB |
| Clone Number | 1C10 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | AAH20688 |
Western Blot detection against Immunogen (51.59 KDa).
Detection limit for recombinant GST tagged USP15 is 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to USP15 on HeLa cell. [antibody concentration 10 ug/ml]
USP15 monoclonal antibody (M01), clone 1C10 Western Blot analysis of USP15 expression in HepG2.
Western Blot analysis of USP15 expression in transfected 293T cell line by USP15 monoclonal antibody (M01), clone 1C10. Lane 1: USP15 transfected lysate (Predicted MW: 109.3 KDa). Lane 2: Non-transfected lysate.
