USP12 Rabbit Polyclonal Antibody

SKU: orb582903

Description

Rabbit polyclonal antibody to USP12

Research Area

Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human USP12
• Target: USP12
• Protein Sequence: Synthetic peptide located within the following region: ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG
• Molecular Weight: 43 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

UBH1, USP12L1

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-USP12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.

Quick Database Links

Gene Symbol

USP12

UniProt

O75317

RefSeq (Protein):NP_872294