You have no items in your shopping cart.
Cart summary
UPK2 Protein, Mouse, Recombinant (GST & His)
Catalog Number: orb1976954
| Catalog Number | orb1976954 |
|---|---|
| Category | Proteins |
| Description | Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM. UPK2 Protein, Mouse, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 40.8 kDa and the accession number is P38575. |
| Tag | N-6xHis-GST |
| Purity | 98.00% |
| MW | 40.8 kDa (predicted) |
| UniProt ID | P38575 |
| Protein Sequence | ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Biological Activity | Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM. UPK2 Protein, Mouse, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 40.8 kDa and the accession number is P38575. |
| Expression Region | 85-184 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
