Cart summary

You have no items in your shopping cart.

    ULK1 Antibody

    Catalog Number: orb654379

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb654379
    CategoryAntibodies
    DescriptionULK1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human ULK1 (EETLMEQEHTEILRGLRFTLLFVQHVLEIAALK).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.25-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat Flow Cytometry, 1-3μg/1x106 cells, Human
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW120 kDa
    UniProt IDO75385
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesSerine/threonine-protein kinase ULK1; Autophagy-re
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    ULK1 Antibody

    Western blot analysis of ULK1 using anti-ULK1 antibody (orb654379). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human A549 whole cell lysates, Lane 2: human THP-1 whole cell lysates, Lane 3: rat brain tissue lysates, Lane 4: mouse brain tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ULK1 antigen affinity purified polyclonal antibody (Catalog # orb654379) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # orb90503) with Tanon 5200 system. A specific band was detected for ULK1 at approximately 120KD. The expected band size for ULK1 is at 120KD.

    ULK1 Antibody

    IHC analysis of ULK1 using anti-ULK1 antibody (orb654379). ULK1 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-ULK1 Antibody (orb654379) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    ULK1 Antibody

    IHC analysis of ULK1 using anti-ULK1 antibody (orb654379). ULK1 was detected in paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-ULK1 Antibody (orb654379) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # orb90444) with DAB as the chromogen.

    ULK1 Antibody

    Flow Cytometry analysis of A549 cells using anti-ULK1 antibody (orb654379). Overlay histogram showing A549 cells stained with orb654379 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ULK1 Antibody (orb654379, 1μg/1x10^6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

    • ULk1 antibody [orb12833]

      ICC,  IF,  WB

      Human, Mouse, Rat

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    • ULK1 Antibody [orb1238633]

      ELISA,  IF,  IHC-P,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      0.1 mg, 0.02 mg
    • Denatured ATG1 antibody [orb39809]

      FC,  IHC-P,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      80 μl
    • ULK1 antibody [orb412774]

      IF,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    • ULK1/Atg1 Rabbit Monoclonal Antibody [orb547392]

      ICC,  IF,  IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Monoclonal

      Unconjugated

      30 μl, 100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars