UHRF1 monoclonal antibody (M01), clone 3A11

• Catalog Number: orb2291209
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant UHRF1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3A11
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: UHRF1 (NP_037414, 694 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
• NCBI: NP_037414
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to UHRF1 on HeLa cell. [antibody concentration 10 ug/ml]

UHRF1 monoclonal antibody (M01), clone 3A11 Western Blot analysis of UHRF1 expression in Hela S3 NE.

Western Blot detection against Immunogen (36.74 KDa).