UGCG monoclonal antibody (M03), clone 1E5

• Catalog Number: orb2291991
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant UGCG.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: UGCG (NP_003349, 33 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG
• Tested applications: ELISA, WB
• Clone Number: 1E5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_003349

Detection limit for recombinant GST tagged UGCG is 0.3 ng/ml as a capture antibody.

UGCG monoclonal antibody (M03), clone 1E5. Western Blot analysis of UGCG expression in HL-60.

Western Blot detection against Immunogen (36.63 KDa).