You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1978228 |
---|---|
Category | Proteins |
Description | UCP1 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 34.9 kDa and the accession number is P25874. |
Tag | N-6xHis |
Purity | 98.00% |
MW | 34.9 kDa (predicted) |
UniProt ID | P25874 |
Protein Sequence | GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT |
Expression System | P. pastoris (Yeast) |
Biological Origin | Human |
Biological Activity | UCP1 Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 34.9 kDa and the accession number is P25874. |
Expression Region | 2-307 aa |
Storage | -20°C |
Note | For research use only |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expiration Date | 6 months from date of receipt. |
> 90% as determined by SDS-PAGE | |
36.2 kDa |
98.00% | |
48.9 kDa (predicted) |