You have no items in your shopping cart.
Cart summary
UCHL5 Protein, Human, Recombinant (His & SUMO)
Catalog Number: orb2816033
| Catalog Number | orb2816033 |
|---|---|
| Category | Proteins |
| Description | UCHL5 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli with N-6xHis-SUMO. The accession number is Q9Y5K5. |
| Tag | N-6xHis-SUMO |
| MW | 53.4 kDa (Predicted) |
| UniProt ID | Q9Y5K5 |
| Protein Sequence | MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKFEKHFEKTLLGK |
| Expression System | E. coli |
| Biological Origin | Human |
| Expression Region | 1-326 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
