UBTF monoclonal antibody (M01), clone 6B6

• Catalog Number: orb2291994
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant UBTF.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: UBTF (NP_055048, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 6B6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_055048

Detection limit for recombinant GST tagged UBTF is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to UBTF on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to UBTF on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]

UBTF monoclonal antibody (M01), clone 6B6 Western Blot analysis of UBTF expression in Hela S3 NE.

Western Blot detection against Immunogen (36.74 KDa).