You have no items in your shopping cart.
Cart summary
Item 1 of 7
Item 1 of 7
UBQLN2 monoclonal antibody (M03), clone 5F5
Catalog Number: orb2291199
| Catalog Number | orb2291199 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant UBQLN2. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 5F5 |
| Tested applications | ELISA, IF, WB |
| Reactivity | Human, Mouse, Rat |
| Isotype | IgG2a Kappa |
| Immunogen | UBQLN2 (NP_038472, 555 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS |
| NCBI | NP_038472 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged UBQLN2 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to UBQLN2 on A-431 cell. [antibody concentration 10 ug/ml]
UBQLN2 monoclonal antibody (M03), clone 5F5 Western Blot analysis of UBQLN2 expression in A-431.
UBQLN2 monoclonal antibody (M03), clone 5F5. Western Blot analysis of UBQLN2 expression in NIH/3T3.
UBQLN2 monoclonal antibody (M03), clone 5F5. Western Blot analysis of UBQLN2 expression in PC-12.
UBQLN2 monoclonal antibody (M03), clone 5F5. Western Blot analysis of UBQLN2 expression in Raw 264.7.
Western Blot detection against Immunogen (33.44 KDa).
