UBE2T monoclonal antibody (M01), clone 1E12-4A3

• Catalog Number: orb2291216
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant UBE2T.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E12-4A3
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2b kappa
• Immunogen: UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
• NCBI: AAH04152
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of UBE2T transfected lysate using anti-UBE2T monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UBE2T MaxPab rabbit polyclonal antibody.

UBE2T monoclonal antibody (M01), clone 1E12-4A3 Western Blot analysis of UBE2T expression in Hela.

Western Blot detection against Immunogen (47.41 KDa).