UBE2G2 monoclonal antibody (M01), clone 5E1

• Catalog Number: orb2291996
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant UBE2G2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5E1
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: UBE2G2 (NP_003329, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGR
• NCBI: NP_003329
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged UBE2G2 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to UBE2G2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1 ug/ml]

UBE2G2 monoclonal antibody (M01), clone 5E1 Western Blot analysis of UBE2G2 expression in HeLa.

Western Blot analysis of UBE2G2 expression in transfected 293T cell line by UBE2G2 monoclonal antibody (M01), clone 5E1. Lane 1: UBE2G2 transfected lysate (15.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.31 KDa).