You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291997 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant UBE2D3. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4C1-1E3 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG1 kappa |
Immunogen | UBE2D3 (AAH03395, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
NCBI | AAH03395 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged UBE2D3 is approximately 1 ng/ml as a capture antibody.
UBE2D3 monoclonal antibody (M01), clone 4C1-1E3 Western Blot analysis of UBE2D3 expression in Jurkat.
Western Blot analysis of UBE2D3 expression in transfected 293T cell line by UBE2D3 monoclonal antibody (M01), clone 4C1-1E3. Lane 1: UBE2D3 transfected lysate (16.7 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (41.91 KDa).