UBE2D3 monoclonal antibody (M01), clone 4C1-1E3

• Catalog Number: orb2291997
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant UBE2D3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4C1-1E3
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: UBE2D3 (AAH03395, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
• NCBI: AAH03395
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged UBE2D3 is approximately 1 ng/ml as a capture antibody.

UBE2D3 monoclonal antibody (M01), clone 4C1-1E3 Western Blot analysis of UBE2D3 expression in Jurkat.

Western Blot analysis of UBE2D3 expression in transfected 293T cell line by UBE2D3 monoclonal antibody (M01), clone 4C1-1E3. Lane 1: UBE2D3 transfected lysate (16.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (41.91 KDa).