You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334570 |
---|---|
Category | Antibodies |
Description | UBE1C/UBA3 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Monkey, Rabbit |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human UBE1C (409-448aa KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 51852 MW |
UniProt ID | Q8TBC4 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | NEDD8-activating enzyme E1 catalytic subunit;6.3.2 Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A549 cells using anti-UBE1C antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of UBE1C using anti-UBE1C antibody.Lane 1:human HeLa Cell;2:human HEK293 Cell;3:rat brain Tissue.
IF analysis of UBE1C using anti-UBE1C antibody. UBE1C was detected in immunocytochemical section of A431 cell.
IHC analysis of UBE1C using anti-UBE1C antibody. UBE1C was detected in a paraffin-embedded section of mouse testis tissue.
IHC analysis of UBE1C using anti-UBE1C antibody. UBE1C was detected in a paraffin-embedded section of rat testis tissue.
WB | |
Canine, Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
WB | |
Canine, Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
WB | |
Canine, Human, Monkey, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating