TYRO3 monoclonal antibody (M05), clone 4F6

• Catalog Number: orb2292000
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TYRO3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4F6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: TYRO3 (AAH49368, 50 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VKLTVSQGQPVRLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAV
• NCBI: AAH49368
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TYRO3 is approximately 0.1 ng/ml as a capture antibody.

Western Blot analysis of TYRO3 expression in transfected 293T cell line by TYRO3 monoclonal antibody (M05), clone 4F6. Lane 1: TYRO3 transfected lysate (96.9 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of TYRO3 over-expressed 293 cell line, cotransfected with TYRO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TYRO3 monoclonal antibody (M05) clone 4F6 (Cat # orb2292000). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.52 KDa).