TXNDC1 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2290788
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human TXNDC1 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: TXNDC1 (NP_110382.2, 1 a.a. ~ 280 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAPSGSLAVPLAVMVPLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMIFVADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS
• NCBI: NP_110382.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

TXNDC1 MaxPab polyclonal antibody. Western Blot analysis of TXNDC1 expression in human pancreas.

Western Blot analysis of TXNDC1 expression in transfected 293T cell line by TXNDC1 MaxPab polyclonal antibody. Lane 1: TXNDC transfected lysate(30.8 KDa). Lane 2: Non-transfected lysate.