You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292003 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant TXN. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | TXN (AAH03377, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV |
Tested applications | ELISA, IF, IP, WB |
Clone Number | 2A7 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH03377 |
Detection limit for recombinant GST tagged TXN is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to TXN on HeLa cell. [antibody concentration 10 ug/ml]
Immunoprecipitation of TXN transfected lysate using anti-TXN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TXN MaxPab rabbit polyclonal antibody.
TXN monoclonal antibody (M01), clone 2A7 Western Blot analysis of TXN expression in HeLa.
Western Blot analysis of TXN expression in transfected 293T cell line by TXN monoclonal antibody (M01), clone 2A7. Lane 1: TXN transfected lysate (11.7 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.29 KDa).