TWIST2 monoclonal antibody (M01), clone 3C8

• Catalog Number: orb2290677
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant TWIST2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3C8
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH
• NCBI: AAH33168
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TWIST2 is 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TWIST2 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml]

Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M01), clone 3C8. Lane 1: TWIST2 transfected lysate(18.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (43.34 KDa).