You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290677 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant TWIST2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3C8 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH |
NCBI | AAH33168 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged TWIST2 is 0.3 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to TWIST2 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml]
Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M01), clone 3C8. Lane 1: TWIST2 transfected lysate(18.1 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (43.34 KDa).