Cart summary

You have no items in your shopping cart.

    Tuberin/TSC2 Antibody (Phospho-Thr1462) : HRP

    Tuberin/TSC2 Antibody (Phospho-Thr1462) : HRP

    Catalog Number: orb2071493

    DispatchUsually dispatched within 5-10 working days
    $ 578.00
    Catalog Numberorb2071493
    CategoryAntibodies
    DescriptionTuberin/TSC2 Antibody (Phospho-Thr1462) : HRP
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsELISA, IHC
    ImmunogenThe antiserum was produced against synthesized peptide derived from human Tuberin/TSC2 around the phosphorylation site of Thr1462.
    Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
    ConjugationHRP
    MW200 kDa
    UniProt IDP49815
    Protein SequenceSynthetic peptide located within the following region: AAWSASGEDSRGQPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVER
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
    Alternative namesLAM, TSC4, PPP1R160
    Read more...
    NoteFor research use only
    Application notesApplication Info: IHC: 1:50~1:100ELISA: 1:1000
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars