You have no items in your shopping cart.
Cart summary
TUBB3 Peptide - N-terminal region
Catalog Number: orb2000128
| Catalog Number | orb2000128 |
|---|---|
| Category | Proteins |
| Description | TUBB3 Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: QIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAI |
| UniProt ID | Q13509 |
| MW | 49 kDa |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CDCBM, FEOM3, TUBB4, CDCBM1, CFEOM3, beta-4, CFEOM Read more... |
| Note | For research use only |
| NCBI | NP_001184110.1 |
