Cart summary

You have no items in your shopping cart.

TUBB3 Peptide - N-terminal region

TUBB3 Peptide - N-terminal region

Catalog Number: orb2000128

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2000128
CategoryProteins
DescriptionTUBB3 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: QIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAI
UniProt IDQ13509
MW49 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesCDCBM, FEOM3, TUBB4, CDCBM1, CFEOM3, beta-4, CFEOM
Read more...
NoteFor research use only
NCBINP_001184110.1