Cart summary

You have no items in your shopping cart.

TUBA1A Peptide - N-terminal region

TUBA1A Peptide - N-terminal region

Catalog Number: orb1999322

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1999322
CategoryProteins
DescriptionTUBA1A Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW36 kDa
UniProt IDP68363
Protein SequenceSynthetic peptide located within the following region: NACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVF
NCBINP_001257328.1
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesLIS3, TUBA3, B-ALPHA-1
Read more...
NoteFor research use only
Expiration Date6 months from date of receipt.