You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2050521 |
---|---|
Category | Proteins |
Description | TTR Recombinant Protein (Mouse) |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 29.5 kDa |
UniProt ID | P07309 |
Protein Sequence | AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN |
Source | E.coli |
NCBI | NP_038725 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | AA408768;AI787086;D17860;prea;prealbumin;transthyr Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
26.6 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
15.6 kDa | |
Yeast |
Greater than 95% as determined by SDS-PAGE. | |
16.4 kDa | |
Mammalian cell |
Greater than 90% as determined by SDS-PAGE. | |
29.5 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
29.5 kDa | |
E.coli |
Filter by Rating