TSPAN8 monoclonal antibody (M02), clone 1E5

• Catalog Number: orb2292049
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TSPAN8.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E5
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG3 Lambda
• Immunogen: TSPAN8 (NP_004607, 110 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN
• NCBI: NP_004607
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TSPAN8 is approximately 10 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to TSPAN8 on 293T cell. [antibody concentration 10 ug/ml]

Western Blot analysis of TSPAN8 expression in transfected 293T cell line by TSPAN8 monoclonal antibody (M02), clone 1E5. Lane 1: TSPAN8 transfected lysate (Predicted MW: 26.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.3 KDa).