You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292049 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant TSPAN8. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1E5 |
Tested applications | ELISA, IF, WB |
Reactivity | Human |
Isotype | IgG3 Lambda |
Immunogen | TSPAN8 (NP_004607, 110 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN |
NCBI | NP_004607 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged TSPAN8 is approximately 10 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to TSPAN8 on 293T cell. [antibody concentration 10 ug/ml]
Western Blot analysis of TSPAN8 expression in transfected 293T cell line by TSPAN8 monoclonal antibody (M02), clone 1E5. Lane 1: TSPAN8 transfected lysate (Predicted MW: 26.1 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.3 KDa).