TSPAN1 monoclonal antibody (M05), clone 3B4

• Catalog Number: orb2291619
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TSPAN1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B4
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: TSPAN1 (NP_005718, 110 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: YTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTN
• NCBI: NP_005718
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TSPAN1 is approximately 3 ng/ml as a capture antibody.

Western Blot detection against Immunogen (36.96 KDa).