You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290781 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant TSC22D4. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4G7 |
Tested applications | ELISA, IF, WB |
Reactivity | Human, Rat |
Isotype | IgG1 Kappa |
Immunogen | TSC22D4 (AAH01966, 1 a.a. ~ 395 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MSGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPDPGGKGTPRNGSPPPGAPSSRFRVVKLPHGLGEPYRRGRWTCVDVYERDLEPHSFGGLLEGIRGASGGAGGRSLDSRLELASLGLGAPTPPSGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLVVPSKAKAEKPPLSASSPQQRPPEPETGESAGTSRAATPLPSLRVEAEAGGSGARTPPLSRRKAVDMRLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSPDPFGAVAAQKFSLAHSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRELAERNAALEQENGLLRALASPEQLAQLPSSGVPRLGPPAPNGPSV |
NCBI | AAH01966 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged TSC22D4 is approximately 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to TSC22D4 on HeLa cell. [antibody concentration 10 ug/ml]
TSC22D4 monoclonal antibody (M07), clone 4G7 Western Blot analysis of TSC22D4 expression in Hela S3 NE.
TSC22D4 monoclonal antibody (M07), clone 4G7. Western Blot analysis of TSC22D4 expression in PC-12.
Western Blot detection against Immunogen (68.97 KDa).