TSC22D3 polyclonal antibody (A01)

• Catalog Number: orb2293473
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant TSC22D3.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: ELISA, WB
• Reactivity: Human
• Immunogen: TSC22D3 (NP_932174, 1 a.a. ~ 97 a.a) partial recombinant protein with GST tag.
• Conjugation: Unconjugated
• Protein Sequence: MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT
• NCBI: NP_932174
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: 50 % glycerol
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

TSC22D3 polyclonal antibody (A01), Western Blot analysis of TSC22D3 expression in Daoy. isoform: 22.213KDa

Western Blot detection against Immunogen (36.78 KDa).