TRIM32 monoclonal antibody (M09), clone 2E5

• Catalog Number: orb2291373
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TRIM32.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TRIM32 (NP_036342, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: RRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRK
• Tested applications: ELISA, IF, WB
• Clone Number: 2E5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_036342

Detection limit for recombinant GST tagged TRIM32 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to TRIM32 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of TRIM32 expression in transfected 293T cell line by TRIM32 monoclonal antibody (M09), clone 2E5. Lane 1: TRIM32 transfected lysate(72 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of TRIM32 over-expressed 293 cell line, cotransfected with TRIM32 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM32 monoclonal antibody (M09), clone 2E5 (Cat # orb2291373). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).