TRIM24 monoclonal antibody (M01), clone 2F2

• Catalog Number: orb2291828
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TRIM24.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG3 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: TRIM24 (AAH28689, 432 a.a. ~ 569 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW
• Tested applications: ELISA, IF, IHC-P, IP, WB
• Clone Number: 2F2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH28689

Immunofluorescence of monoclonal antibody to TRIM24 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to TRIM24 on formalin-fixed paraffin-embedded human testis. [antibody concentration 6 ug/ml]

Immunoprecipitation of TRIM24 transfected lysate using anti-TRIM24 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIM24 MaxPab rabbit polyclonal antibody.

TRIM24 monoclonal antibody (M01), clone 2F2 Western Blot analysis of TRIM24 expression in IMR-32.

TRIM24 monoclonal antibody (M01), clone 2F2. Western Blot analysis of TRIM24 expression in Hela S3 NE.

Western Blot analysis of TRIM24 expression in transfected 293T cell line by TRIM24 monoclonal antibody (M01), clone 2F2. Lane 1: TRIM24 transfected lysate (116.8 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (40.81 KDa).