You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291222 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant TRIB2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1B1 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2b Lambda |
Immunogen | TRIB2 (NP_067675, 254 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN |
NCBI | NP_067675 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged TRIB2 is approximately 0.03 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to TRIB2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Western Blot analysis of TRIB2 expression in transfected 293T cell line by TRIB2 monoclonal antibody (M04), clone 1B1. Lane 1: TRIB2 transfected lysate(38.8 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of TRIB2 over-expressed 293 cell line, cotransfected with TRIB2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIB2 monoclonal antibody (M04), clone 1B1 (Cat # orb2291222). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (35.64 KDa).