TRIB2 monoclonal antibody (M04), clone 1B1

• Catalog Number: orb2291222
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TRIB2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1B1
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2b Lambda
• Immunogen: TRIB2 (NP_067675, 254 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
• NCBI: NP_067675
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TRIB2 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TRIB2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Western Blot analysis of TRIB2 expression in transfected 293T cell line by TRIB2 monoclonal antibody (M04), clone 1B1. Lane 1: TRIB2 transfected lysate(38.8 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of TRIB2 over-expressed 293 cell line, cotransfected with TRIB2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIB2 monoclonal antibody (M04), clone 1B1 (Cat # orb2291222). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (35.64 KDa).