You have no items in your shopping cart.
Cart summary
Item 1 of 4
Item 1 of 4
TRIB1 monoclonal antibody (M01), clone 4A10
Catalog Number: orb2291604
| Catalog Number | orb2291604 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant TRIB1. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 4A10 |
| Tested applications | ELISA, WB |
| Reactivity | Human |
| Isotype | IgG1 Kappa |
| Immunogen | TRIB1 (NP_079471, 91 a.a. ~ 191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | IADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVS |
| NCBI | NP_079471 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged TRIB1 is approximately 0.1 ng/ml as a capture antibody.
TRIB1 monoclonal antibody (M01), clone 4A10. Western Blot analysis of TRIB1 expression in human colon.
TRIB1 monoclonal antibody (M01), clone 4A10. Western Blot analysis of TRIB1 expression in human stomach.
Western Blot detection against Immunogen (36.85 KDa).
