TRI41 antibody

• Catalog Number: orb324829
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TRI41
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Canine, Human, Mouse, Porcine, Rabbit, Rat, Yeast
• Reactivity: Canine, Equine, Human, Mouse, Porcine, Rat, Yeast
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRI41
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56kDa
• Target: TRIM41
• UniProt ID: Q8WV44
• Protein Sequence: Synthetic peptide located within the following region: VQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELD
• NCBI: NP_963921
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti TRIM41 antibody, anti RINCK antibody, anti an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human HepG2 Whole Cell tissue using TRI41 antibody