You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291141 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant TRAPPC4. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2D10 |
Tested applications | ELISA, IF, WB |
Reactivity | Human, Mouse |
Isotype | IgG1 Kappa |
Immunogen | TRAPPC4 (AAH10866, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS |
NCBI | AAH10866 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged TRAPPC4 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to TRAPPC4 on HeLa cell. [antibody concentration 30 ug/ml]
TRAPPC4 monoclonal antibody (M01), clone 2D10 Western Blot analysis of TRAPPC4 expression in HeLa.
TRAPPC4 monoclonal antibody (M01), clone 2D10. Western Blot analysis of TRAPPC4 expression in NIH/3T3.
TRAPPC4 monoclonal antibody (M01), clone 2D10. Western Blot analysis of TRAPPC4 expression in Raw 264.7.
Western Blot detection against Immunogen (49.83 KDa).