You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2051533 |
---|---|
Category | Proteins |
Description | TPD52L1 Recombinant Protein (Human) |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 49.4 kDa |
UniProt ID | Q16890 |
Protein Sequence | MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC |
Source | E.coli |
NCBI | NP_001003395 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | D53;TPD53;tumor protein D52 like 1;Tumor protein D Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
49.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
49.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
49.4 kDa | |
E.coli |
Filter by Rating