You have no items in your shopping cart.
Cart summary
Item 1 of 1
TPD52 polyclonal antibody (A01)
Catalog Number: orb2292034
| Catalog Number | orb2292034 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a partial recombinant TPD52. |
| Clonality | Polyclonal |
| Species/Host | Mouse |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | 50 % glycerol |
| Immunogen | TPD52 (NP_005070, 100 a.a. ~ 184 a.a) partial recombinant protein with GST tag. |
| Protein Sequence | SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL |
| Tested applications | ELISA, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_005070 |
Western Blot detection against Immunogen (35.46 KDa).
