You have no items in your shopping cart.
Cart summary
TOX3 Peptide - N-terminal region
Catalog Number: orb2002797
| Catalog Number | orb2002797 |
|---|---|
| Category | Proteins |
| Description | TOX3 Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: MKCQPRSGARRIEERLHYLITTYLKFGNNNNYMNMAEANNAFFAASETFH |
| UniProt ID | O15405 |
| MW | 62kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with TOX3 Rabbit Polyclonal Antibody (orb330445). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | TOX3,CAGF9,TNRC9, |
| Note | For research use only |
| NCBI | NP_001139660 |
