TOP2A monoclonal antibody (M01), clone 1E2

• Catalog Number: orb2292035
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant TOP2A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E2
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: TOP2A (NP_001058, 1435 a.a. ~ 1531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
• NCBI: NP_001058
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TOP2A is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to TOP2A on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to TOP2A on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]

TOP2A monoclonal antibody (M01), clone 1E2 Western Blot analysis of TOP2A expression in Hela S3 NE.

Western Blot detection against Immunogen (36.41 KDa).