You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292035 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant TOP2A. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | TOP2A (NP_001058, 1435 a.a. ~ 1531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 1E2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001058 |
Detection limit for recombinant GST tagged TOP2A is approximately 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to TOP2A on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to TOP2A on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
TOP2A monoclonal antibody (M01), clone 1E2 Western Blot analysis of TOP2A expression in Hela S3 NE.
Western Blot detection against Immunogen (36.41 KDa).