You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292036 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant TOP1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | TOP1 (NP_003277, 692 a.a. ~ 765 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 1A1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_003277 |
Detection limit for recombinant GST tagged TOP1 is approximately 0.3 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]
Immunoperoxidase of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1~10 ug/ml]
TOP1 monoclonal antibody (M01), clone 1A1. Western Blot analysis of TOP1 expression in HeLa.
TOP1 monoclonal antibody (M01), clone 1A1. Western Blot analysis of TOP1 expression in human ovarian cancer.
TOP1 monoclonal antibody (M01), clone 1A1. Western Blot analysis of TOP1 expression in JAR.
Western Blot detection against Immunogen (33.88 KDa).