TOMM22 monoclonal antibody (M01J), clone 4G4

• Catalog Number: orb2290959
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant TOMM22.This product is belong to Cell Culture Grade Antibody (CX Grade).
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4G4
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Kappa
• Immunogen: TOMM22 (AAH09363, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
• NCBI: AAH09363
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TOMM22 is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to TOMM22 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to TOMM22 on formalin-fixed paraffin-embedded human small intestine. [antibody concentration 3 ug/ml]

TOMM22 monoclonal antibody (M01J), clone 4G4. Western Blot analysis of TOMM22 expression in NIH/3T3.

TOMM22 monoclonal antibody (M01J), clone 4G4. Western Blot analysis of TOMM22 expression in PC-12.

TOMM22 monoclonal antibody (M01J), clone 4G4. Western Blot analysis of TOMM22 expression in Raw 264.7.

Western Blot analysis of TOMM22 expression in transfected 293T cell line by TOMM22 monoclonal antibody (M01J), clone 4G4. Lane 1: TOMM22 transfected lysate (Predicted MW: 15.73 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of TOMM22 over-expressed 293 cell line, cotransfected with TOMM22 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TOMM22 monoclonal antibody (M01), clone 4G4. GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (41.36 KDa).