TNNC1 monoclonal antibody (M01), clone 1F8-A9

• Catalog Number: orb2292041
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant TNNC1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F8-A9
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: TNNC1 (AAH30244, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
• NCBI: AAH30244
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged TNNC1 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to TNNC1 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]

Western Blot analysis of TNNC1 expression in transfected 293T cell line by TNNC1 monoclonal antibody (M01), clone 1F8-A9. Lane 1: TNNC1 transfected lysate (18.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (43.45 KDa).